Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTDEQVCETVEKYGANREECARLNASLSCLRNVHMSGGNLSKQDWTIQWP TTETGKENNPVCPPEPTPWIRTHLSQSPRVPSKCVQHYCHTSPTPGAPVY THVDRLTVDAYPGLCPPPPLESGHRSLPPSPRQRHAVRTPPRTPNIVTTV TPPGTPPMRKKNKLKPPGTPPPSSRKLIHLIPGFTALHRSKSHEFQLGHR VDEAHTPKAKKKSKPLNLKIHSSVGSCENIPSQQRSPLLSERSLRSFFVG HAPFLPSTPPVHTEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYWM SQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDPARLVR TESVPCDINNPLRKPPRYSDLHISQTLPKTNKINKDHIPVPYQPDSSSNP SSTTSSTPSSPAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQ QFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV HDEAEESEDDFEEMNLSLLSARSFPRKASQTSIFLQEWDIPFEQLEIGEL IGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHEN VVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIV KGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDK LRIQNGWLCHLAPEIIRQLSPDTEEDKLPFSKHSDVFALGTIWYELHARE WPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFCWAFEQEERPTF TKLMDMLEKLPKRNRRLSHPGHFWKSAEL
    • Amino acids
      1 to 829
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ25965
    • hKSR 2
    • hKSR2
    • Kinase suppressor of Ras 2
    • KSR 2
    • Ksr2
    • KSR2_HUMAN
    see all
  • Function
    Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.
  • Tissue specificity
    Mainly expressed in brain and kidney.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications
    Phosphorylated on Ser-474 by MARK3.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab166135 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up