Recombinant Human Kv beta 1 protein (ab159905)

Overview

  • Product name
    Recombinant Human Kv beta 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQVSIACTEHNLKSRNGEDRLLSKQSSTAPNVVNAARAKFRTVAIIARSL GTFTPQHHISLKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISD EVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVIT TKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPM EEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAE YHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRAS LKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEG VSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYR S
    • Amino acids
      1 to 401
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hKvb3
    • hKvBeta3
    • K(+) channel subunit beta-1
    • KCAB1_HUMAN
    • KCNA1B
    • KCNAB1
    • Kv-beta-1
    • Kvb1.3
    • Voltage-gated potassium channel beta-1 subunit
    • Voltage-gated potassium channel subunit beta-1
    see all
  • Function
    Accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit. All three isoforms alter the functional properties of Kv1.4 and Kv1.5. Isoform KvB1.2 has no effect on Kv1.1, Kv1.2 or Kv2.1.
  • Tissue specificity
    In brain, expression is most prominent in caudate nucleus, hippocampus and thalamus. Significant expression also detected in amygdala and subthalamic nucleus. Also expressed in both healthy and cardiomyopathic heart. Up to four times more abundant in left ventricle than left atrium.
  • Sequence similarities
    Belongs to the shaker potassium channel beta subunit family.
  • Domain
    Alteration of functional properties of alpha subunit is mediated through N-terminal domain of beta subunit.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab159905 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up