Recombinant Human Kv1.1 potassium channel protein (ab114350)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ09470
    • SpeciesHuman
    • SequenceNFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEE DMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
    • Molecular weight35 kDa including tags
    • Amino acids410 to 495

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114350 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AEMK
    • EA1
    • Episodic ataxia with myokymia
    • HBK1
    • HUK1
    • Kca1 1
    • Kcna1
    • KCNA1_HUMAN
    • Kcpvd
    • KV1.1
    • MBK1
    • mceph
    • MGC124402
    • MGC126782
    • MGC138385
    • MK1
    • MK1, mouse, homolog of KV1.1
    • Potassium channel protein 1
    • Potassium voltage gated channel shaker related subfamily member 1
    • Potassium voltage gated channel subfamily A member 1
    • Potassium voltage gated channel, shaker related subfamily, member 1 (episodic ataxia with myokymia)
    • Potassium voltage-gated channel subfamily A member 1
    • RBK1
    • RCK1
    • Shak
    • Shaker related subfamily member 1
    • Voltage gated potassium channel subunit Kv1.1
    • Voltage-gated K(+) channel HuKI
    • Voltage-gated potassium channel HBK1
    • Voltage-gated potassium channel subunit Kv1.1
    see all
  • FunctionMediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
  • Involvement in diseaseDefects in KCNA1 are the cause of episodic ataxia type 1 (EA1) [MIM:160120]; also known as paroxysmal or episodic ataxia with myokymia (EAM) or paroxysmal ataxia with neuromyotonia. EA1 is an autosomal dominant disorder characterized by brief episodes of ataxia and dysarthria. Neurological examination during and between the attacks demonstrates spontaneous, repetitive discharges in the distal musculature (myokymia) that arise from peripheral nerve. Nystagmus is absent.
    Defects in KCNA1 are the cause of myokymia isolated type 1 (MK1) [MIM:160120]. Myokymia is a condition characterized by spontaneous involuntary contraction of muscle fiber groups that can be observed as vermiform movement of the overlying skin. Electromyography typically shows continuous motor unit activity with spontaneous oligo- and multiplet-discharges of high intraburst frequency (myokymic discharges). Isolated spontaneous muscle twitches occur in many persons and have no grave significance.
  • Sequence similaritiesBelongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily.
  • DomainThe N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications
    Palmitoylated on Cys-243; which may be required for membrane targeting.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Kv1.1 potassium channel protein images

  • ab114350 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Kv1.1 potassium channel protein (ab114350)

ab114350 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114350.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"