Overview

  • Product name
    Recombinant Human Kv1.4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEY LEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      562 to 652

Specifications

Our Abpromise guarantee covers the use of ab152487 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Voltage gated K+ channel HuKII
    • Fetal skeletal muscle potassium channel
    • HBK4
    • HK1
    • HPCN2
    • HUKII
    • Kcna4
    • KCNA4_HUMAN
    • KCNA4L
    • KCNA8
    • kv1.4
    • PCN2
    • Potassium channel 2
    • Potassium voltage gated channel shaker related subfamily member 4
    • Potassium voltage gated channel subfamily A member 4
    • Potassium voltage-gated channel subfamily A member 4
    • Rapidly inactivating potassium channel
    • Shaker related potassium channel Kv1.4
    • Type A potassium channel
    • Voltage gated potassium channel HBK4
    • Voltage gated potassium channel HK1
    • Voltage gated potassium channel subunit Kv1.4
    • Voltage-gated K(+) channel HuKII
    • Voltage-gated potassium channel HBK4
    • Voltage-gated potassium channel HK1
    • Voltage-gated potassium channel subunit Kv1.4
    see all
  • Function
    Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
  • Sequence similarities
    Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.4/KCNA4 sub-subfamily.
  • Domain
    The N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152487 stained with Coomassie Blue.

References

ab152487 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152487.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up