Overview

  • Product name
    Recombinant Human l-Myc protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPG AGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFS ARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE PKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGP SPPLFG
    • Amino acids
      1 to 206
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe38
    • Class E basic helix-loop-helix protein 38
    • l myc 1 proto oncogene
    • L myc 1 proto-oncogene protein
    • l myc protein
    • LMYC
    • Myc related gene from lung cancer
    • MYCL
    • MYCL 1
    • MYCL1
    • MYCL1_HUMAN
    • oncogene lmyc
    • Protein L-Myc-1
    • v myc avian myelocytomatosis viral oncogene homolog 1 lung carcinoma derived
    see all
  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158935 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up