Recombinant Human L3MBTL2 protein (ab164439)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKPRSIEETPSSEPMEEEEDDDLELFGGYDSFRSYNSSVGSESSSYLEE SSEAENEDREAGELPTSPLHLLSPGTPRSLDGSGSEPAVCEMCGIVGTRE AFFSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAWSA KIGAFLHSQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKH VPLYDQWEDVMKGMKVEVLNSDAVLPSRVYWIASVIQTAGYRVLLRYEGF ENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKR LVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIG GRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHH PTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATV CKVLLDGYLMICVDGGPSTDGLDWFCYHASSHAIFPATFCQKNDIELTPP KGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGMKLEAVDLMEP RLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQ LQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLL EDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIK QETDD
    • Amino acids
      1 to 705
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3bt like 2 protein
    • 3bt like protein
    • DKFZP761I141
    • H-l(3)mbt-like protein
    • H-l(3)mbt-like protein 2
    • Hl
    • Hl(3)mbt like protein
    • Hl(3)mbtl
    • L
    • l(3)mbt like 2
    • l(3)mbt like 2 (Drosophila)
    • L(3)mbt-like 2 protein
    • L(3)mbt-like protein 2
    • L3MBTL2
    • Lethal
    • Lethal(3)malignant brain tumor-like 2 protein
    • Lethal(3)malignant brain tumor-like protein 2
    • LMBL2_HUMAN
    see all
  • Function
    Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated 'Lys-20' on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on 'Lys-4', 'Lys-9' or 'Lys-27'.
  • Sequence similarities
    Contains 1 FCS-type zinc finger.
    Contains 4 MBT repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164439 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up