Recombinant human Lactate Dehydrogenase B protein (ab96765)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSAR FRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG TDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSR IHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKS ADTLWDIQKDLKDL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 334
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 6 units/mg. in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37°C.

    Activity Assay

    1. Prepare a 1.5 ml reaction mix into a suitable container, adjust to pH7.5 at 37°C, and pre-chill on ice before use: The final concentrations are 100mM Sodium phosphate, 0.12 mM beta-nicotinamide adenine dinucleotide, reduced form, 2.3mM Pyruvate, 0.033% (w/v) bovine serum albumin.
    2. Equilibrate to 37°C and monitor at A340nm until the value is constant using a spectrophotometer
    3. Add 50ul of recombinant LDHB protein in various concentrations (0.1ug, 0.5ug) in assay buffer.
    4. Mix by inversion and record the increase at A340nm for 5 minutes.
  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab96765 is purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Epididymis secretory protein Li 281
    • HEL S 281
    • L lactate dehydrogenase B chain
    • L-lactate dehydrogenase B chain
    • Lactate dehydrogenase H chain
    • LDH B
    • LDH H
    • LDH heart subunit
    • LDH-B
    • LDH-H
    • LDHB
    • LDHB_HUMAN
    • LDHBD
    • LDHH
    • Renal carcinoma antigen NY REN 46
    • Renal carcinoma antigen NY-REN-46
    • TRG-5
    • TRG5
    see all
  • Pathway
    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease
    Note=Defects in LDHB result in deficiency of lactate dehydrogenase, a condition with no clear symptomatic consequences. Lactate dehydrogenase deficiency can probably be considered a non-disease.
  • Sequence similarities
    Belongs to the LDH/MDH superfamily. LDH family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab96765 at approximately 38.8kDa (3µg).

References

ab96765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up