Recombinant human Lactate Dehydrogenase B protein (ab96765)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP07195
    • SpeciesHuman
    • SequenceMGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGS LFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSAR FRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMG TDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSR IHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKS ADTLWDIQKDLKDL
    • Molecular weight37 kDa including tags
    • Amino acids1 to 334
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 6 units/mg. in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37°C.

    Activity Assay

    1. Prepare a 1.5 ml reaction mix into a suitable container, adjust to pH7.5 at 37°C, and pre-chill on ice before use: The final concentrations are 100mM Sodium phosphate, 0.12 mM beta-nicotinamide adenine dinucleotide, reduced form, 2.3mM Pyruvate, 0.033% (w/v) bovine serum albumin.
    2. Equilibrate to 37°C and monitor at A340nm until the value is constant using a spectrophotometer
    3. Add 50ul of recombinant LDHB protein in various concentrations (0.1ug, 0.5ug) in assay buffer.
    4. Mix by inversion and record the increase at A340nm for 5 minutes.
  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab96765 is purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Epididymis secretory protein Li 281
    • HEL S 281
    • L lactate dehydrogenase B chain
    • L-lactate dehydrogenase B chain
    • Lactate dehydrogenase H chain
    • LDH B
    • LDH H
    • LDH heart subunit
    • LDH-B
    • LDH-H
    • LDHB
    • LDHB_HUMAN
    • LDHBD
    • LDHH
    • Renal carcinoma antigen NY REN 46
    • Renal carcinoma antigen NY-REN-46
    • TRG-5
    • TRG5
    see all
  • PathwayFermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in diseaseNote=Defects in LDHB result in deficiency of lactate dehydrogenase, a condition with no clear symptomatic consequences. Lactate dehydrogenase deficiency can probably be considered a non-disease.
  • Sequence similaritiesBelongs to the LDH/MDH superfamily. LDH family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant human Lactate Dehydrogenase B protein images

  • 15% SDS-PAGE showing ab96765 at approximately 38.8kDa (3µg).

References for Recombinant human Lactate Dehydrogenase B protein (ab96765)

ab96765 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"