Overview

  • Product name
    Recombinant Human LAD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRL SGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      418 to 517

Specifications

Our Abpromise guarantee covers the use of ab116948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LAD
    • Lad 1
    • Lad-1
    • Lad1
    • LAD1_HUMAN
    • LADA
    • Ladinin 1
    • Ladinin-1
    • Linear IgA bullous dermatosis antigen
    • Linear IgA disease antigen
    • Linear IgA disease antigen homolog
    • MGC10355
    see all
  • Function
    Anchoring filament protein which is a component of the basement membrane zone.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Recombinant Human LAD1 protein images

  • 12.5% SDS-PAGE showing ab116948 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human LAD1 protein (ab116948)

ab116948 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up