Overview

  • Product name
    Recombinant Human LAD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SESVKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRL SGVVTSRLNLWISRTQESGDQDPQEAQKASSATERTQWGQKSDSSLDAEV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      418 to 517

Specifications

Our Abpromise guarantee covers the use of ab116948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LAD
    • Lad 1
    • Lad-1
    • Lad1
    • LAD1_HUMAN
    • LADA
    • Ladinin 1
    • Ladinin-1
    • Linear IgA bullous dermatosis antigen
    • Linear IgA disease antigen
    • Linear IgA disease antigen homolog
    • MGC10355
    see all
  • Function
    Anchoring filament protein which is a component of the basement membrane zone.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116948 at approximately 36.63kDa stained with Coomassie Blue.

References

ab116948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up