Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6ISS4
    • SpeciesHuman
    • SequenceMSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCR GPVGVQTFRLEREDRAKYKDSYNVFRLGPSESEARFHIDSVSEGNAGLYR CLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGTVPGTEASGFD AP
    • Molecular weight43 kDa including tags
    • Amino acids1 to 152

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD306
    • CD306 antigen
    • LAIR 2
    • LAIR-2
    • LAIR2
    • LAIR2_HUMAN
    • Leukocyte associated Ig like receptor 2
    • Leukocyte associated immunoglobulin like receptor 2
    • Leukocyte-associated immunoglobulin-like receptor 2
    • MGC71634
    • OTTHUMP00000068389
    • OTTHUMP00000068390
    see all
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human LAIR2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117034 at approximately 42.79 kDa.

References for Recombinant Human LAIR2 protein (ab117034)

ab117034 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"