Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
    • Molecular weight
      15 kDa including tags
    • Amino acids
      22 to 152
    • Tags
      His tag C-Terminus
    • Additional sequence information
      AAH69366

Specifications

Our Abpromise guarantee covers the use of ab182705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of HT-29 human colon adenocarcinoma cells.
    When 10000 cells/well are added to ab182705 coated plates (50 μg/ml with 100 μl/well), approximately >40% cells will adhere after 10 minutes at 37°C.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 100% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD306
    • CD306 antigen
    • LAIR 2
    • LAIR-2
    • LAIR2
    • LAIR2_HUMAN
    • Leukocyte associated Ig like receptor 2
    • Leukocyte associated immunoglobulin like receptor 2
    • Leukocyte-associated immunoglobulin-like receptor 2
    • MGC71634
    • OTTHUMP00000068389
    • OTTHUMP00000068390
    see all
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab182705 stained overnight with Coomassie Blue.

References

ab182705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up