Overview

  • Product name
    Recombinant Human LAMB3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAE ELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHING RVLYYATC
    • Amino acids
      1064 to 1171
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BM600 125KDA
    • Epiligrin subunit bata
    • FLJ99565
    • Kalinin B1 chain
    • Kalinin subunit beta
    • LAM5
    • LAMB3
    • LAMB3_HUMAN
    • Laminin B1k chain
    • Laminin subunit beta-3
    • Laminin-5 subunit beta
    • LAMNB1
    • Nicein subunit beta
    see all
  • Function
    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity
    Found in the basement membranes (major component).
  • Involvement in disease
    Defects in LAMB3 are a cause of epidermolysis bullosa junctional Herlitz type (H-JEB) [MIM:226700]; also known as junctional epidermolysis bullosa Herlitz-Pearson type. JEB defines a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement membrane. H-JEB is a severe, infantile and lethal form. Death occurs usually within the first six months of life. Occasionally, children survive to teens. H-JEB is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic.
    Defects in LAMB3 are a cause of generalized atrophic benign epidermolysis bullosa (GABEB) [MIM:226650]. GABEB is a non-lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities.
  • Sequence similarities
    Contains 6 laminin EGF-like domains.
    Contains 1 laminin N-terminal domain.
  • Domain
    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain VI is globular.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • ab158811 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up