Overview

  • Product name
    Recombinant Human LAMC2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQ INSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPG CYNTQALEQQ
    • Amino acids
      1084 to 1193
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3918
    • B2T
    • BM600
    • Cell-scattering factor 140 kDa subunit
    • CSF
    • CSF 140 kDa subunit
    • EBR2
    • EBR2A
    • Epiligrin subunit gamma
    • Kalinin subunit gamma
    • Kalinin/nicein/epiligrin 100 kDa subunit
    • Ladsin 140 kDa subunit
    • LAMB2T
    • LAMC2
    • LAMC2_HUMAN
    • Laminin 5 gamma 2 subunit
    • Laminin B2t chain
    • Laminin gamma 2
    • laminin gamma 2 chain
    • Laminin subunit gamma-2
    • Laminin-5 subunit gamma
    • LAMNB2
    • Large adhesive scatter factor 140 kDa subunit
    • MGC138491
    • MGC141938
    • Nicein subunit gamma
    • NICEIN-100KDA
    see all
  • Function
    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells.
  • Tissue specificity
    The large variant is expressed only in specific epithelial cells of embryonic and neonatal tissues. In 17-week old embryo the small variant is found in cerebral cortex, lung, and distal tubes of kidney, but not in epithelia except for distal tubuli.
  • Involvement in disease
    Defects in LAMC2 are a cause of epidermolysis bullosa junctional Herlitz type (H-JEB) [MIM:226700]; also known as junctional epidermolysis bullosa Herlitz-Pearson type. JEB defines a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement membrane. H-JEB is a severe, infantile and lethal form. Death occurs usually within the first six months of life. Occasionally, children survive to teens. H-JEB is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic.
  • Sequence similarities
    Contains 8 laminin EGF-like domains.
    Contains 1 laminin IV type A domain.
  • Domain
    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain IV is globular.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane. Major component.
  • Information by UniProt

Images

  • ab158812 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up