Recombinant Human Lamin B1 protein (ab114163)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20700
    • SpeciesHuman
    • SequenceMATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKV RSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARER AKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALA TALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQS LTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMR EQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRI ESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAE IRDQMQQQLNDYEQLLDVKLALDMEIS AYRKLLQGEEERLKLSPSPSS RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEE IDVD GKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQ TVTIWAANAGVTASPPTDLIWKNQNSWGTGE DVKVILKNSQGEEVAQR STVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
    • Molecular weight91 kDa including tags
    • Amino acids1 to 586

Specifications

Our Abpromise guarantee covers the use of ab114163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114163 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADLD
    • lamin B1
    • Lamin-B1
    • LMN
    • LMN2
    • LMNB
    • Lmnb1
    • LMNB1_HUMAN
    • MGC111419
    • OTTHUMP00000159218
    see all
  • FunctionLamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin.
  • Involvement in diseaseDefects in LMNB1 are the cause of leukodystrophy demyelinating autosomal dominant adult-onset (ADLD) [MIM:169500]. ADLD is a slowly progressive and fatal demyelinating leukodystrophy, presenting in the fourth or fifth decade of life. Clinically characterized by early autonomic abnormalities, pyramidal and cerebellar dysfunction, and symmetric demyelination of the CNS. It differs from multiple sclerosis and other demyelinating disorders in that neuropathology shows preservation of oligodendroglia in the presence of subtotal demyelination and lack of astrogliosis.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Post-translational
    modifications
    B-type lamins undergo a series of modifications, such as farnesylation and phosphorylation. Increased phosphorylation of the lamins occurs before envelope disintegration and probably plays a role in regulating lamin associations.
  • Cellular localizationNucleus inner membrane.
  • Information by UniProt

Recombinant Human Lamin B1 protein images

  • 12.5% SDS-PAGE analysis of ab114163, stained with Coomassie Blue.

References for Recombinant Human Lamin B1 protein (ab114163)

ab114163 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"