Recombinant Human Laminin alpha 5 protein (ab152495)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSV TVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP GYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWLTDGS YLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQIQVFLLGGS RKRVLVRVERATVYSVEQDNDLELADAYYLGGVPPDQLPPSLRRLFPTGG SVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLLVGRAMTFHGHGFLRL ALSNVAPLTGNVYSGFGFHSAQDSALLYYRASPDGLCQVSLQQGRVSLQL LRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPELQ PQPEGPPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGS VNVSTGCAPALQAQTPGLGPRGLQATARKASRRSRQPARHPACMLPPHLR TTRDSYQFGGSLSSHLEFVGILARHRNWPSLSMHVLPRSSRGLLLFTARL RPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKN RILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPTSQ ELHCLMWAWNWRCGPWQSPD
    • Molecular weight
      100 kDa including tags
    • Amino acids
      1 to 670
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0533
    • KIAA1907
    • LAMA5
    • Laminin alpha 5 chain
    • Laminin subunit alpha 5
    • Laminin subunit alpha-5
    • Laminin, alpha 5
    • Laminin-10 subunit alpha
    • Laminin-11 subunit alpha
    • Laminin-15 subunit alpha
    • RP11-157P1.6
    see all
  • Relevance
    Laminins are a family of heterotrimeric extracellular glycoproteins consisting of alpha, beta, and gamma chains. Laminins are thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminin alpha 5 (LAMA5) belongs to the alpha subfamily of laminin chains and is a major component of basement membranes. Laminin alpha 5 is the alpha chain in the Laminin 15 complex which is a heterotrimer composed of alpha 5/beta 2/gamma 3 which are bound to each other by disulfide bonds into a cross shaped molecule comprising one long and three short arms with globules at each end.
  • Cellular localization
    Secreted; basement membrane.

Images

  • 12.5% SDS-PAGE analysis of ab152495 stained with Coomassie Blue.

References

ab152495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up