Recombinant Human Laminin gamma 1 protein (ab114156)

Overview

  • Product name
    Recombinant Human Laminin gamma 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
    • Molecular weight
      30 kDa
    • Amino acids
      1 to 39
    • Additional sequence information
      This sequence is Human LAMC1 full-length ORF ( AAH15586, 1 a.a. - 38 a.a.). It is not the full length human LAMC1 protein (UniProt accession P11047).

Specifications

Our Abpromise guarantee covers the use of ab114156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114156 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LAMB2
    • lamc1
    • LAMC1_HUMAN
    • Laminin B2 chain
    • Laminin subunit gamma-1
    • Laminin, gamma 1 (formerly LAMB2)
    • Laminin-1 subunit gamma
    • Laminin-10 subunit gamma
    • Laminin-11 subunit gamma
    • Laminin-2 subunit gamma
    • Laminin-3 subunit gamma
    • Laminin-4 subunit gamma
    • Laminin-6 subunit gamma
    • Laminin-7 subunit gamma
    • Laminin-8 subunit gamma
    • Laminin-9 subunit gamma
    • MGC87297
    • S-LAM gamma
    • S-laminin subunit gamma
    see all
  • Function
    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity
    Found in the basement membranes (major component).
  • Sequence similarities
    Contains 11 laminin EGF-like domains.
    Contains 1 laminin IV type A domain.
    Contains 1 laminin N-terminal domain.
  • Domain
    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domains VI and IV are globular.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Recombinant Human Laminin gamma 1 protein images

  • 12.5% SDS-PAGE analysis of ab114156, stained with Coomassie Blue.

References for Recombinant Human Laminin gamma 1 protein (ab114156)

ab114156 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up