Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP13473
    • SpeciesHuman
    • SequenceELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSIC GDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
    • Molecular weight36 kDa including tags
    • Amino acids30 to 127

Specifications

Our Abpromise guarantee covers the use of ab114167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114167 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD107 antigen-like family member B
    • CD107b
    • LAMP 2
    • LAMP 2C
    • LAMP-2
    • LAMP2
    • LAMP2_HUMAN
    • LAMPB
    • LGP110
    • Lysosomal associated membrane protein 2
    • Lysosome associated membrane protein 2
    • Lysosome-associated membrane glycoprotein 2
    • Lysosome-associated membrane protein 2
    • MAC3
    see all
  • FunctionImplicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter-and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens.
  • Tissue specificityIsoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver.
  • Involvement in diseaseDefects in LAMP2 are the cause of Danon disease (DAND) [MIM:300257]; also known as glycogen storage disease type 2B (GSD2B). DAND is a lysosomal glycogen storage disease characterized by the clinical triad of cardiomyopathy, vacuolar myopathy and mental retardation. It is often associated with an accumulation of glycogen in muscle and lysosomes.
  • Sequence similaritiesBelongs to the LAMP family.
  • Post-translational
    modifications
    O- and N-glycosylated; some of the 16 N-linked glycans are polylactosaminoglycans.
  • Cellular localizationCell membrane. Endosome membrane. Lysosome membrane. This protein shuttles between lysosomes, endosomes, and the plasma membrane.
  • Information by UniProt

Recombinant Human LAMP2 protein images

  • 12.5% SDS-PAGE analysis of ab114167, stained with Coomassie Blue.

References for Recombinant Human LAMP2 protein (ab114167)

ab114167 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"