Overview

  • Product name
    Recombinant Human LAP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP PLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDK PRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLRE QGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
    • Molecular weight
      20 kDa
    • Amino acids
      2 to 187

Specifications

Our Abpromise guarantee covers the use of ab151936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151936 has a purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. 0.2 µM filtered.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Lamina associated polypeptide 2
    • LAP 2
    • LEM domain containing 4
    • LEMD4
    • Thymopoietin
    • Thymopoietin isoform alpha
    • Thymopoietin related peptide isoform alpha
    • Thymopoietin related peptide isoforms beta/gamma
    • Thymopoietin, isoforms beta/gamma
    • TMPO
    • TP
    • TP alpha
    • TP beta/gamma
    • TPRP isoform alpha
    • TPRP isoforms beta/gamma
    see all
  • Relevance
    Lamins are type V intermediate filament proteins and are grouped into constitutively expressed B-type lamins and developmentally regulated A-type lamins. Lamin-binding proteins in the nuclear lamina and the nuclear interior include several protein families and/or types of proteins in higher eukaryotes such as the inner nuclear membrane proteins, lamin B receptor, emerin, and MANI, three isoforms of lamina-associated polypeptide 1 (LAP1), and several isoforms of LAP2. Up to six LAP 2 isoforms derive from a single gene by alternative splicing in mammals and various isoforms have been described in Xenopus. The best characterized LAP2 isoforms are the inner nuclear membrane protein LAP2 beta and the nucleoplasmic protein LAP2 alpha, which are identical in their N-terminal 187-amino acid constant region but differ in their C termini. While LAP2 beta binds to B-type lamins at the nuclear periphery and was suggested to regulate nuclear lamina growth , LAP2 alpha specifically interacts with A-type lamins within the nuclear interior as part of a detergent/salt-resistant nucleoskeletal structure.
  • Cellular localization
    Nuclear

References

ab151936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up