Recombinant Human LAPTM4B protein (ab163080)

Overview

  • Product name
    Recombinant Human LAPTM4B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADP DQYNFSSSELGGVFEFMDDANMCIAIAISLLMILICAMATYGAYKQRAAW IIPFFCYQIFDFALNMLVAITVLIYPNSIQEYTRQLPPNFPYRDDVMSVN PTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDT TVLLPPYDDATVNGAAKEPPPPYVSA
    • Amino acids
      1 to 226
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LAPTM4beta
    • LC27
    • Lysosomal associated protein transmembrane 4 beta
    • Lysosomal associated transmembrane protein 4 beta
    • Lysosomal associated transmembrane protein 4B
    • Lysosomal protein transmembrane 4 beta
    see all
  • Relevance
    LAPTM4B belongs to the LAPTM4/LAPTM5 transporter family. It has an active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
  • Cellular localization
    Endomembrane system; Multi pass membrane protein.

Images

  • ab163080 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up