Overview

  • Product name
    Recombinant Human LARG protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGE DLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE
    • Amino acids
      817 to 916
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHGC_HUMAN
    • ARHGEF12
    • KIAA0382
    • leukemia-associated rho guanine nucleotide exchange factor
    • Leukemia-associated RhoGEF
    • PRO2792
    • Rho guanine exchange factor (GEF) 12
    • Rho guanine nucleotide exchange factor (GEF) 12
    • Rho guanine nucleotide exchange factor 12
    • Similar to Mouse Lsc oncogene
    see all
  • Function
    May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13.
  • Tissue specificity
    Ubiquitously expressed. Isoform 2 is found in jejunum and testis.
  • Involvement in disease
    A chromosomal aberration involving ARHGEF12 may be a cause of acute leukemia. Translocation t(11;11)(q23;23) with KMT2A/MLL1.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
    Contains 1 RGSL (RGS-like) domain.
  • Cellular localization
    Cytoplasm. Membrane. Translocated to the membrane upon stimulation.
  • Information by UniProt

Images

  • ab161613 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up