Overview

  • Product name
    Recombinant Human LARGE protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLGICRGRRKFLAASLSLLCIPAITWIYLFSGSFEDGKPVSLSPLESQAH SPRYTASSQRERESLEVRMREVEEENRALRRQLSLAQGRAPSHRRGNHSK TYSMEEGTGDSENLRAGIVAGNSSECGQQPVVEKCETIHVAIVCAGYNAS RDVVTLVKSVLFHRRNPLHFHLIADSIAEQILATLFQTWMVPAVRVDFYN ADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIVLDTDITFATD IAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHRPWPALGRGYNTGVI LLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVY QLPCFWNVQLSDHTRSEQCYRDVSDLKVIHWNSPKKLRVKNKHVEFFRNL YLTFLEYDGNLLRRELFGCPSEADVNSENLQKQLSELDEDDLCYEFRRER FTVHRTHLYFLHYEYEPAADSTDVTLVAQLSMDRLQMLEAICKHWEGPIS LALYLSDAEAQQFLRYAQGSEVLMSRHNVGYHIVYKEGQFYPVNLLRNVA MKHISTPYMFLSDIDFLPMYGLYEYLRKSVIQLDLANTKKAMIVPAFETL RYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTATTPYR VEWEADFEPYVVVRRDCPEYDRRFVGFGWNKVAHIMELDVQEYEFIVLPN AYMIHMPHAPSFDITKFRSNKQYRICLKTLKEEFQQDMSRRYGFAALKYL TAENNS
    • Amino acids
      1 to 756
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acetylglucosaminyltransferase like protein
    • Acetylglucosaminyltransferase-like 1A
    • Acetylglucosaminyltransferase-like protein
    • Glycosyltransferase-like protein LARGE1
    • KIAA0609
    • Large
    • LARGE_HUMAN
    • LARGE1
    • Like acetylglucosaminyltransferase
    • Like glycosyltransferase
    • MDC1D
    • MDDGA6
    • MDDGB6
    see all
  • Function
    Glycosyltransferase which participates in glycosylation of alpha-dystroglycan. May carry out the synthesis of glycoprotein and glycosphingolipid sugar chains. May be involved in the addition of a repeated disaccharide unit.
  • Tissue specificity
    Ubiquitous. Highest expression in heart, brain and skeletal muscle.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Muscular dystrophy-dystroglycanopathy congenital with mental retardation B6
    Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A6
  • Sequence similarities
    Belongs to the glycosyltransferase 8 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160387 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up