Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPV PQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD
    • Amino acids
      806 to 903
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HLASA
    • KIAA0028
    • LARS 2
    • Lars2
    • Leucine translase
    • Leucine tRNA ligase
    • Leucine tRNA ligase 2
    • Leucine tRNA ligase 2 mitocondrial
    • Leucine--tRNA ligase
    • Leucyl tRNA synthetase 2
    • Leucyl tRNA synthetase 2 mitochondrial
    • LeuRS
    • MGC26121
    • mtLeuRS
    • PRLTS4
    • Probable leucyl-tRNA synthetase, mitochondrial
    • SYLM_HUMAN
    see all
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab161622 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up