Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14847
    • SpeciesHuman
    • SequenceMNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKK PYCNAHYPKQSFTMVADTPENLRLKQQSRLQSQVRYKEEFEKNKGKGFSV VADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGS SYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAP GGGGKRYRAAYDYSAADEDAVSFQDGDTIVNVQQIDDGWMYGTVERTGDT GMLPANYVEAI
    • Molecular weight54 kDa including tags
    • Amino acids1 to 261

Specifications

Our Abpromise guarantee covers the use of ab114888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LASP 1
    • LASP-1
    • LASP1
    • LASP1_HUMAN
    • LIM and SH3 domain protein 1
    • LIM and SH3 protein 1
    • Metastatic lymph node gene 50 protein
    • MLN 50
    • MLN50
    • OTTHUMP00000164238
    • OTTHUMP00000164239
    see all
  • FunctionPlays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types.
  • Sequence similaritiesContains 1 LIM zinc-binding domain.
    Contains 2 nebulin repeats.
    Contains 1 SH3 domain.
  • Cellular localizationCytoplasm > cell cortex. Cytoplasm > cytoskeleton. Associated with the F-actin rich cortical cytoskeleton.
  • Information by UniProt

Recombinant Human LASP1 protein images

  • 12.5% SDS-PAGE showing ab114888 at approximately 54.45kDa.
    Stained with Coomassie Blue.

References for Recombinant Human LASP1 protein (ab114888)

ab114888 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"