Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQ CGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWR
    • Amino acids
      57 to 139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ceramide synthase 4
    • CerS4
    • FLJ12089
    • LAG1 homolog ceramide synthase 4
    • LAG1 longevity assurance homolog 4
    • LAG1, S. cerevisiae, homolog of, 4
    • LASS 4
    • LASS4
    • LASS4 LAG1 homolog ceramide synthase 4
    • LASS4_HUMAN
    • TRAM homolog 1
    • Trh 1
    • Trh1
    see all
  • Function
    May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing different fatty acid donors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 1 TLC (TRAM/LAG1/CLN8) domain.
  • Cellular localization
    Nucleus membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab164046 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up