Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43561-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYPRGIQFKRPHT VAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANS VASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTP GIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTE PAALSSQEAEEVEEEGAPDYENLQELN
    • Molecular weight24 kDa including tags
    • Amino acids28 to 233
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113124 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT

General Info

  • Alternative names
    • 36 kDa phospho tyrosine adapter protein
    • 36 kDa phospho-tyrosine adapter protein
    • 36 kDa phospho-tyrosine adaptor protein
    • lat
    • LAT 1
    • LAT_HUMAN
    • LAT1
    • Linker for activation of T cells
    • Linker for activation of T cells family member 1
    • linker for activation of T cells, transmembrane adaptor
    • Linker for activation of T-cells family member 1
    • p36 38
    • p36-38
    • pp36
    see all
  • FunctionRequired for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
  • Tissue specificityExpressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
  • Post-translational
    modifications
    Phosphorylated on tyrosines by ZAP-70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ.
    Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.
  • Cellular localizationCell membrane. Present in lipid rafts.
  • Information by UniProt

Recombinant Human LAT protein images

  • 15% SDS-PAGE analysis of ab113124 (3 µg).
    Molecular weight on SDS-PAGE will appear higher.

References for Recombinant Human LAT protein (ab113124)

ab113124 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"