Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRL SQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRK
    • Amino acids
      212 to 297
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • L type amino acid transporter 3
    • L-type amino acid transporter 3
    • Large neutral amino acids transporter small subunit 3
    • LAT3_HUMAN
    • PB39
    • POV1
    • Prostate cancer overexpressed gene 1 protein
    • R00504
    • SLC43A1
    • Solute carrier family 43 member 1
    see all
  • Function
    Sodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.
  • Tissue specificity
    In adults, found in all tissues examined with highest expression in pancreas. In fetus, highest expression in liver and lower levels in kidney, and lung. High levels found in prostate cancer cells.
  • Sequence similarities
    Belongs to the SLC43A transporter (TC 2.A.1.44) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160057 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up