Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGR YEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKL QGSFDVSVKGISISVDLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLG WLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNK MVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFV PRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFPSRRDH PP
    • Molecular weight
      76 kDa including tags
    • Amino acids
      26 to 477

Specifications

Our Abpromise guarantee covers the use of ab114808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BPI fold containing family D, member 2
    • Bpifd2
    • LBP
    • LBP_HUMAN
    • LBP1
    • Lipopolysaccharide binding protein
    • Lipopolysaccharide-binding protein
    • LPS binding protein
    • Ly88
    • MGC22233
    • OTTHUMP00000030965
    • RP23-407H16.4
    see all
  • Function
    Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor.
  • Sequence similarities
    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human LBP protein images

  • ab114808 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human LBP protein (ab114808)

ab114808 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up