Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMR ADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
    • Amino acids
      95 to 194
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ladybird homeobox 2
    • Ladybird homeobox homolog 2
    • Ladybird homeobox homolog 2 (Drosophila)
    • Ladybird homeobox protein homolog 2
    • Ladybird like homeobox 2
    • Ladybird like homeodomain protein 2
    • Lbx 2
    • Lbx2
    • LBX2_HUMAN
    • LP3727
    • RGD1561172
    • Transcription factor LBX2
    see all
  • Function
    Putative transcription factor.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164765 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up