Overview

  • Product name
    Recombinant Human LC3C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFL PPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSAT MAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLEDRPCNPL
    • Amino acids
      1 to 147
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATG8J
    • Autophagy-related protein LC3 C
    • Autophagy-related ubiquitin-like modifier LC3 C
    • LC3 like protein 2
    • MAP1 light chain 3 like protein 2
    • MAP1 light chain 3 like protein 3
    • MAP1 light chain 3-like protein 3
    • MAP1A/MAP1B LC3 C
    • MAP1A/MAP1B light chain 3 C
    • MAP1LC3C
    • Microtubule-associated protein 1 light chain 3 gamma
    • Microtubule-associated proteins 1A/1B light chain 3C
    • MLP3C_HUMAN
    see all
  • Function
    Probably involved in formation of autophagosomal vacuoles (autophagosomes).
  • Tissue specificity
    Most abundant in placenta, lung and ovary.
  • Sequence similarities
    Belongs to the MAP1 LC3 family.
  • Post-translational
    modifications
    The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II.
  • Cellular localization
    Cytoplasm > cytoskeleton. Endomembrane system. Cytoplasmic vesicle > autophagosome membrane. LC3-II binds to the autophagic membranes.
  • Information by UniProt

Images

  • ab166539 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up