Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP31025
    • SpeciesHuman
    • SequenceSDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTM LISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
    • Molecular weight36 kDa including tags
    • Amino acids24 to 120

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LCN1
    • LCN1_HUMAN
    • Lipocalin 1 (protein migrating faster than albumin, tear prealbumin)
    • Lipocalin 1 like 2
    • Lipocalin-1
    • PMFA
    • Tear lipocalin
    • Tear prealbumin
    • Tlc
    • TP
    • VEG protein
    • VEGP
    • Von Ebner gland protein
    see all
  • FunctionCould play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
  • Tissue specificityMainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human LCN1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116834 at approximately 36.30 kDa.

References for Recombinant Human LCN1 protein (ab116834)

ab116834 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"