Overview

  • Product name
    Recombinant Human LCN12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAG NSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQ PGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLG RSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGNMVHLQACWAVGTGPA GMSLVDPRGAGPSVYPGSSAPACAQGSPGSWVPVLNPGSEPPPAAPGPLS WATSSHPGSPVPGHLLPPQVPCPGPPPPAPPAPGPLSRPTSSHPGSPVLG YLLPPQVPCPGPSPPSGSPVLGHLLPSPIPAHKELGLIPGGALDLSSLPW VAAPA
    • Amino acids
      1 to 355
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Epididymal-specific lipocalin-12
    • LCN12
    • LCN12_HUMAN
    • Lipocalcin 12
    • Lipocalin 12
    • MGC34753
    • MGC48935
    see all
  • Function
    Binds all-trans retinoic acid and may act as a retinoid carrier protein within the epididymis. May play a role in male fertility.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab166223 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up