Recombinant Human LD78 beta protein (ab104122)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP16619
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFE TSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
    • Molecular weight10 kDa including tags
    • Amino acids26 to 93
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104122 was purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

General Info

  • Alternative names
    • 464.2
    • C C motif chemokine 3 like 1
    • CCL3L1
    • CCL3L3
    • Chemokine (C C motif) ligand 3 like 1
    • Chemokine (C C motif) ligand 3 like 3
    • Chemokine (C C motif) ligand 3 like, centromeric
    • chemokine (CC motif) ligand 3 like 1
    • CL3L1_HUMAN
    • D17S1718
    • G0/G1 switch regulatory protein 19-2
    • G0S19-2
    • LD78
    • LD78 beta(1-70)
    • LD78-beta(1-70)
    • LD78-beta(5-70)
    • LD78BETA
    • MGC104178
    • MGC12815
    • MGC182017
    • MIP1AP
    • PAT 464.2
    • SCYA3L
    • SCYA3L1
    • Small inducible cytokine A3 like 1 precursor
    • Small-inducible cytokine A3-like 1
    • Tonsillar lymphocyte LD78 beta
    • Tonsillar lymphocyte LD78 beta protein
    see all
  • FunctionChemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta(3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta(3-70) is also a ligand for CCR1, CCR3 and CCR5.
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    The N-terminal processed forms LD78-beta(3-70) and LD78-beta(5-70) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. The cleavage to yield LD78-beta(3-70) is probably achieved by DPP4.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human LD78 beta protein images

  • 15% SDS-PAGE analysis of 3µg ab104122.

References for Recombinant Human LD78 beta protein (ab104122)

ab104122 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"