Overview

  • Product name
    Recombinant Human LDB2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLW WDAFATEFFEDDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDL YYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFD DLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFT LNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQRMVAPPAEPT RQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVM VVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNS PWNSKPPATQETKSENPPPQASQ
    • Amino acids
      1 to 373
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carboxyl terminal LIM domain binding protein 1
    • Carboxyl terminal LIM domain protein 1
    • Carboxyl-terminal LIM domain-binding protein 1
    • CLIM 1
    • CLIM-1
    • CLIM1
    • LDB 1
    • LDB 2
    • LDB-2
    • LDB1
    • LDB2
    • LDB2_HUMAN
    • LIM binding domain 2
    • LIM domain binding 2
    • LIM domain binding factor 2
    • LIM domain binding factor CLIM 1
    • LIM domain binding factor CLIM1
    • LIM domain binding protein 2
    • LIM domain-binding factor CLIM1
    • LIM domain-binding protein 2
    • OTTHUMP00000158632
    • OTTHUMP00000217823
    • OTTHUMP00000217824
    • OTTHUMP00000217825
    • OTTHUMP00000217827
    see all
  • Function
    Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.
  • Sequence similarities
    Belongs to the LDB family.
  • Post-translational
    modifications
    Ubiquitinated by RLIM/RNF12, leading to its degradation by the proteasome.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160328 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up