Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15467
    • SpeciesHuman
    • SequenceQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNR EVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
    • Molecular weight11 kDa
    • Amino acids24 to 120
    • Additional sequence informationCCL16 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa.

Specifications

Our Abpromise guarantee covers the use of ab116400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityDetermined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 1,000-10,000IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity> 97 % SDS-PAGE.
    ab116400 purified by proprietary chromatographic techniques.
  • FormLyophilised
  • Additional notesLyophilized ab116400 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution, it should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 0.88% Sodium chloride, 0.28% Sodium phosphate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile ultra pure water not less than 100µg/ml, which can then be further diluted into other aqueous solutions.

General Info

  • Alternative names
    • C-C motif chemokine 16
    • CCL16
    • CCL16_HUMAN
    • Chemokine (C-C motif) ligand 16
    • Chemokine CC-4
    • Chemokine LEC
    • CKb12
    • HCC-4
    • HCC4
    • IL-10-inducible chemokine
    • IL10 inducible chemokine
    • ILINCK
    • LCC-1
    • LCC1
    • Liver CC chemokine 1 precursor
    • Liver expressed chemokine
    • Liver-expressed chemokine
    • LMC
    • Lymphocyte and monocyte chemoattractant
    • Monotactin 1
    • Monotactin-1
    • MTN-1
    • Mtn1
    • NCC-4
    • NCC4
    • New CC chemokine 4
    • SCYA16
    • SCYL4
    • Small inducible cytokine A16 precursor
    • Small inducible cytokine subfamily A (Cys Cys) member 16
    • Small-inducible cytokine A16
    see all
  • FunctionShows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
  • Tissue specificityMainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human LEC protein (ab116400)

ab116400 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"