Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLP LQKVYPGIQSHVHIENCDSSDPTAYL
    • Amino acids
      76 to 151
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • chm II
    • chm2
    • Chondromodulin II
    • hLECT2
    • LECT 2
    • LECT-2
    • LECT2
    • LECT2_HUMAN
    • Leukocyte cell derived chemotaxin 2
    • Leukocyte cell-derived chemotaxin-2
    • MGC126628
    see all
  • Function
    Has a neutrophil chemotactic activity. Also a positive regulator of chondrocyte proliferation.
  • Tissue specificity
    Highly expressed in adult and fetal liver and weakly in testis. Not expressed in bone marrow.
  • Sequence similarities
    Belongs to the LECT2/MIM-1 family.
  • Cellular localization
    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • ab158816 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up