Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEP YHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLS PPIPRT
    • Amino acids
      33 to 138
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586H0919
    • FLJ46390
    • LEF 1
    • LEF-1
    • Lef1
    • LEF1_HUMAN
    • Lymphoid enhancer binding factor 1
    • Lymphoid enhancer-binding factor 1
    • T cell specific transcription factor 1 alpha
    • T cell-specific transcription factor 1-alpha
    • TCF 1 alpha
    • TCF1 alpha
    • TCF1-alpha
    • TCF10
    • TCF1alpha
    • TCF7L3
    • Transcription factor T cell specific 1 alpha
    see all
  • Function
    Participates in the Wnt signaling pathway. Activates transcription of target genes in the presence of CTNNB1 and EP300. May play a role in hair cell differentiation and follicle morphogenesis. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1. Regulates T-cell receptor alpha enhancer function. Binds DNA in a sequence-specific manner. PIAG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (By similarity). Isoform 3 lacks the CTNNB1 interaction domain and may be an antagonist for Wnt signaling. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells.
  • Tissue specificity
    Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are detected in several pancreatic cell lines.
  • Sequence similarities
    Belongs to the TCF/LEF family.
    Contains 1 HMG box DNA-binding domain.
  • Domain
    Proline-rich and acidic regions are implicated in the activation functions of RNA polymerase II transcription factors.
  • Cellular localization
    Nucleus. Found in nuclear bodies upon PIASG binding.
  • Information by UniProt

Images

  • ab153337 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up