Recombinant Human LEFTY2 protein (ab159691)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK LVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLV FGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWL RVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQ VSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGD CDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQP PEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQK CSCASDGALVPRRLQP
    • Amino acids
      1 to 366
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EBAF
    • Endometrial bleeding associated factor
    • Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily)
    • Endometrial bleeding-associated factor
    • Left right determination factor 2
    • Left right determination factor A
    • Left-right determination factor 2
    • Left-right determination factor A
    • LEFTA
    • LEFTY 2
    • LEFTY2
    • LEFTYA
    • LFTY2 transforming growth factor, beta -4
    • LFTY2, mouse, homolog of
    • LFTY2_HUMAN
    • MGC46222
    • Protein lefty 2
    • Protein lefty A
    • Protein lefty-2
    • Protein lefty-A
    • Protein lefty2
    • PSEC0024
    • TGF beta 4
    • TGF-beta-4
    • TGFB4
    • Transforming growth factor beta 4
    • Transforming growth factor beta-4
    see all
  • Function
    Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
  • Tissue specificity
    Mesenchymal cells of the endometrial stroma.
  • Involvement in disease
    Defects in LEFTY2 are the cause of left-right axis malformations (LRAM) [MIM:601877]. The defect includes left pulmonary isomerism, with cardiac anomalies characterized by complete atrioventricular canal defect and hypoplastic left ventricle, and interrupted inferior vena cava.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Developmental stage
    Transiently expressed before and during menstrual bleeding.
  • Post-translational
    modifications
    The processing of the protein may also occur at the second R-X-X-R site located at AA 132-135. Processing appears to be regulated in a cell-type specific manner.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159691 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up