Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRESAKEYRQRSLL EKELLFFA YDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQ EIGNLMKEIETLVEEKTK ESLDVSRLTREGGPLLYEGISLTMNSKLLN GSQRVVMDGVISDHECQELQRLTNVAAT SGDGYRGQTSPHTPNEKFYG VTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYF RLDTPLYFSY SHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRD YSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHGV KAVTRGQR CAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQ PLDAQQGPPEPAQESLSG SESKPKDEL
    • Amino acids
      322 to 736

Specifications

Our Abpromise guarantee covers the use of ab92037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 143 µl aqua dest.

General Info

  • Alternative names
    • GROS 1
    • GROS1
    • Growth suppressor 1
    • LEPRE 1
    • Lepre1
    • Leprecan
    • Leprecan 1
    • Leprecan-1
    • Leprecan1
    • Leucine proline enriched proteoglycan (leprecan) 1
    • Leucine proline enriched proteoglycan 1
    • Leucine- and proline-enriched proteoglycan 1
    • MGC117314
    • OI8
    • P3H1
    • P3H1_HUMAN
    • Prolyl 3 hydroxylase 1
    • Prolyl 3-hydroxylase 1
    see all
  • Function
    Basement membrane-associated chondroitin sulfate proteoglycan (CSPG). Has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. May be involved in the secretory pathway of cells. Has growth suppressive activity in fibroblasts.
  • Involvement in disease
    Defects in LEPRE1 are the cause of osteogenesis imperfecta type 8 (OI8) [MIM:610915]. A connective tissue disorder characterized by disproportionate short stature, severe osteoporosis, shortening of the long bones, white sclerae, a round face and a short barrel-shaped chest.
  • Sequence similarities
    Belongs to the leprecan family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 4 TPR repeats.
  • Post-translational
    modifications
    O-glycosylated; chondroitin sulfate.
  • Cellular localization
    Endoplasmic reticulum. Secreted > extracellular space > extracellular matrix. Secreted into the extracellular matrix as a chondroitin sulfate proteoglycan.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up