Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHTRSIGPRESAKEYRQRSLL EKELLFFA YDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQ EIGNLMKEIETLVEEKTK ESLDVSRLTREGGPLLYEGISLTMNSKLLN GSQRVVMDGVISDHECQELQRLTNVAAT SGDGYRGQTSPHTPNEKFYG VTVFKALKLGQEGKVPLQSAHLYYNVTEKVRRIMESYF RLDTPLYFSY SHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVCVKEPPAYTFRD YSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHGV KAVTRGQR CAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQ PLDAQQGPPEPAQESLSG SESKPKDEL
    • Amino acids322 to 736

Specifications

Our Abpromise guarantee covers the use of ab92037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 143 µl aqua dest.

General Info

  • Alternative names
    • GROS 1
    • GROS1
    • Growth suppressor 1
    • LEPRE 1
    • Lepre1
    • Leprecan
    • Leprecan 1
    • Leprecan-1
    • Leprecan1
    • Leucine proline enriched proteoglycan (leprecan) 1
    • Leucine proline enriched proteoglycan 1
    • Leucine- and proline-enriched proteoglycan 1
    • MGC117314
    • OI8
    • P3H1
    • P3H1_HUMAN
    • Prolyl 3 hydroxylase 1
    • Prolyl 3-hydroxylase 1
    see all
  • FunctionBasement membrane-associated chondroitin sulfate proteoglycan (CSPG). Has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. May be involved in the secretory pathway of cells. Has growth suppressive activity in fibroblasts.
  • Involvement in diseaseDefects in LEPRE1 are the cause of osteogenesis imperfecta type 8 (OI8) [MIM:610915]. A connective tissue disorder characterized by disproportionate short stature, severe osteoporosis, shortening of the long bones, white sclerae, a round face and a short barrel-shaped chest.
  • Sequence similaritiesBelongs to the leprecan family.
    Contains 1 Fe2OG dioxygenase domain.
    Contains 4 TPR repeats.
  • Post-translational
    modifications
    O-glycosylated; chondroitin sulfate.
  • Cellular localizationEndoplasmic reticulum. Secreted > extracellular space > extracellular matrix. Secreted into the extracellular matrix as a chondroitin sulfate proteoglycan.
  • Information by UniProt

Recombinant Human LEPRE1 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human LEPRE1 protein (ab92037)

ab92037 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"