Recombinant human Leptin protein (ab168049)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILT LSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPW ASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
    • Molecular weight
      16 kDa
    • Amino acids
      22 to 167

Associated products

Specifications

Our Abpromise guarantee covers the use of ab168049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    ab168049 induces proliferation of BAF/3 cells stably transfected with the long form of Human leptin receptor.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes
    ab168049 induces proliferation of BAF/3 cells stably transfected with the long form of Human leptin receptor.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 0.038% Sodium bicarbonate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water or 0.4% sodium bicarbonate, pH 8-9. Do not reconstitute to less than 0.1mg/ml. Further dilutions should be made with medium containing 0.1% HSA or BSA. After reconstitution, prepare aliquots and freeze in liquid nitrogen. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • FLJ94114
    • LEP
    • LEP_HUMAN
    • LEPD
    • Leptin
    • Leptin (murine obesity homolog)
    • Leptin (obesity homolog, mouse)
    • Leptin Murine Obesity Homolog
    • Leptin Precursor Obesity Factor
    • OB
    • Obese protein
    • Obese, mouse, homolog of
    • Obesity
    • Obesity factor
    • Obesity homolog mouse
    • Obesity Murine Homolog Leptin
    • OBS
    • OTTHUMP00000212285
    see all
  • Function
    May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
  • Involvement in disease
    Defects in LEP may be a cause of obesity (OBESITY) [MIM:601665]. It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
  • Sequence similarities
    Belongs to the leptin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab168049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up