Overview

  • Product nameRecombinant Human LETM1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO95202
    • SpeciesHuman
    • SequenceESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISV AELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDV HISTSQVA
    • Molecular weight38 kDa including tags
    • Amino acids601 to 708

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best useb within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • LETM 1
    • Letm1
    • LETM1 and EF hand domain containing protein 1, mitochondrial
    • LETM1 and EF-hand domain-containing protein 1
    • LETM1_HUMAN
    • Leucine zipper EF hand containing transmembrane protein 1
    • Leucine zipper-EF-hand-containing transmembrane protein 1
    • Mdm38 homolog
    • mitochondrial
    see all
  • FunctionCrucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain. Required for the maintenance of the tubular shape and cristae organization.
  • Sequence similaritiesContains 1 EF-hand domain.
    Contains 1 LETM1 domain.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt

Recombinant Human LETM1 protein images

  • ab114939 analyzed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human LETM1 protein (ab114939)

ab114939 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"