Recombinant human Leukotriene A4 hydrolase protein (Active) (ab174008)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNL RSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQE IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT PSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPC YLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGG PYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLY SPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQL NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWED AIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT AMLVGKDLKVD
    • Molecular weight
      70 kDa including tags
    • Amino acids
      1 to 611
    • Tags
      His tag C-Terminus
    • Additional sequence information
      NP_000886.1

Specifications

Our Abpromise guarantee covers the use of ab174008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to cleave the fluorogenic peptide substrate, Arg – 7 – amido – 4 – methylcoumarin (R-AMC).
    The specific activity is >50 pmol/min/µg, as measured under the described conditions.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C.

    pH: 7.50
    Constituents: 0.61% Tris, 0.58% Sodium chloride, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 20 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • FLJ17564
    • Leukotriene A(4) hydrolase
    • Leukotriene A-4 hydrolase
    • Leukotriene A4 hydrolase
    • LKHA4_HUMAN
    • LTA-4 hydrolase
    • LTA4
    • LTA4 hydrolase
    • LTA4H
    see all
  • Function
    Hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.
  • Pathway
    Lipid metabolism; leukotriene B4 biosynthesis.
  • Sequence similarities
    Belongs to the peptidase M1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • Reduced SDS-PAGE analysis of ab174008 staining overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 62-72 kDa.

References

ab174008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up