Recombinant Human LGALS14 protein (ab101087)

Overview

  • Product nameRecombinant Human LGALS14 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8TCE9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPI LTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEK CYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVL RDISLTRVLISD
    • Molecular weight19 kDa
    • Amino acids1 to 139
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101087 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Charcot Leyden crystal protein 2
    • Charcot-Leyden crystal protein 2
    • CLC2
    • Gal 14
    • Gal-14
    • Gal14
    • Galectin 14
    • Galectin-14
    • Galectin14
    • Lectin galactoside binding soluble 14
    • LGALS14
    • MGC22235
    • Placental protein 13 like
    • Placental protein 13 like protein
    • Placental protein 13-like
    • PPL13
    • PPL13_HUMAN
    see all
  • FunctionBinds beta-galactoside and lactose. Strong inducer of T-cell apoptosis.
  • Tissue specificityHighly expressed in placenta.
  • Sequence similaritiesContains 1 galectin domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human LGALS14 protein images

  • 15% SDS-PAGE analysis of ab101087 (3 µg).

References for Recombinant Human LGALS14 protein (ab101087)

ab101087 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"