Recombinant Human LGALS14 protein (ab101087)

Overview

  • Product name
    Recombinant Human LGALS14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPI LTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEK CYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVL RDISLTRVLISD
    • Molecular weight
      19 kDa
    • Amino acids
      1 to 139
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101087 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Charcot Leyden crystal protein 2
    • Charcot-Leyden crystal protein 2
    • CLC2
    • Gal 14
    • Gal-14
    • Gal14
    • Galectin 14
    • Galectin-14
    • Galectin14
    • Lectin galactoside binding soluble 14
    • LGALS14
    • MGC22235
    • Placental protein 13 like
    • Placental protein 13 like protein
    • Placental protein 13-like
    • PPL13
    • PPL13_HUMAN
    see all
  • Function
    Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis.
  • Tissue specificity
    Highly expressed in placenta.
  • Sequence similarities
    Contains 1 galectin domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101087 (3 µg).

References

ab101087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up