Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHW HSSCLKCADCQMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQ VVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDYETAKQN DDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRV VQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCG VSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQ TLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF
    • Amino acids
      1 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CPHD4
    • Gsh 4
    • Gsh4
    • Lhx4
    • LHX4_HUMAN
    • LIM Homeobox 4
    • LIM Homeobox gene 4
    • LIM homeobox protein 4
    • LIM/homeobox protein Lhx4
    see all
  • Function
    May play a critical role in the development of respiratory control mechanisms and in the normal growth and maturation of the lung.
  • Involvement in disease
    Defects in LHX4 are the cause of pituitary hormone deficiency combined type 4 (CPHD4) [MIM:262700]; also known as short stature pituitary and cerebellar defects and small sella turcica. The disorder is characterized by short stature, pituitary and cerebellar defects, and small transverse depression crossing the midline on the superior surface of the body of the sphenoid bone which houses the pituitary gland.
    Note=A chromosomal aberration involving LHX4 may be a cause of acute lymphoblastic leukemia. Translocation t(1;14)(q25;q32) with IGHG1.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164795 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up