Recombinant Human LI Cadherin protein (ab114173)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIE REGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNR PTFLQSKY
    • Molecular weight
      38 kDa including tags
    • Amino acids
      24 to 131

Specifications

Our Abpromise guarantee covers the use of ab114173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BILL-cadherin
    • CAD17_HUMAN
    • Cadherin 16
    • Cadherin 16, formerly
    • Cadherin 17
    • cadherin 17, LI cadherin (liver-intestine)
    • cadherin, liver-intestine
    • Cadherin-17
    • CDH16
    • CDH16, formerly
    • Cdh17
    • FLJ26931
    • Formerly Cadherin 16
    • Formerly CDH16
    • HPT 1
    • HPT-1 cadherin
    • human intestinal peptide-associated transporter HPT-1
    • human peptide transporter 1
    • Intestinal peptide-associated transporter HPT 1
    • Intestinal peptide-associated transporter HPT-1
    • LI-cadherin
    • Liver Cadherin
    • liver intestine cadherin
    • Liver-intestine cadherin
    see all
  • Function
    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
  • Tissue specificity
    Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin.
  • Sequence similarities
    Contains 7 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114173 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up