Recombinant Human LI Cadherin protein (ab114173)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12864
    • SpeciesHuman
    • SequenceEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIE REGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNR PTFLQSKY
    • Molecular weight38 kDa including tags
    • Amino acids24 to 131

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BILL-cadherin
    • CAD17_HUMAN
    • Cadherin 16
    • Cadherin 16, formerly
    • Cadherin 17
    • cadherin 17, LI cadherin (liver-intestine)
    • cadherin, liver-intestine
    • Cadherin-17
    • CDH16
    • CDH16, formerly
    • Cdh17
    • FLJ26931
    • Formerly Cadherin 16
    • Formerly CDH16
    • HPT 1
    • HPT-1 cadherin
    • human intestinal peptide-associated transporter HPT-1
    • human peptide transporter 1
    • Intestinal peptide-associated transporter HPT 1
    • Intestinal peptide-associated transporter HPT-1
    • LI-cadherin
    • Liver Cadherin
    • liver intestine cadherin
    • Liver-intestine cadherin
    see all
  • FunctionCadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
  • Tissue specificityExpressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin.
  • Sequence similaritiesContains 7 cadherin domains.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human LI Cadherin protein images

  • ab114173 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human LI Cadherin protein (ab114173)

ab114173 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"