Recombinant Human LILRA3 protein (ab161250)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQ GSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIY GSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVA FDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGY DSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDA GYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGS LSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
    • Amino acids
      1 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 85E
    • CD85 antigen-like family member E
    • CD85e
    • CD85e antigen
    • e3
    • HM 31
    • HM 43
    • HM31
    • HM43
    • ILT 6
    • ILT-6
    • ILT6
    • Immunoglobulin like transcript 6
    • Immunoglobulin-like transcript 6
    • Leucocyte immunoglobulin like receptor
    • Leukocyte immunoglobulin like receptor 4
    • Leukocyte immunoglobulin like receptor A3
    • Leukocyte immunoglobulin like receptor subfamily A (without TM domain) member 3
    • Leukocyte immunoglobulin like receptor subfamily A member 3
    • Leukocyte immunoglobulin-like receptor 4
    • Leukocyte immunoglobulin-like receptor subfamily A member 3
    • LILRA 3
    • LILRA3
    • LIR 4
    • LIR-4
    • LIR4
    • LIRA3_HUMAN
    • Monocyte inhibitory receptor HM43/HM31
    see all
  • Function
    May act as soluble receptor for class I MHC antigens.
  • Tissue specificity
    Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161250 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up