Recombinant Human LILRA5 protein (ab166353)

Overview

  • Product name
    Recombinant Human LILRA5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLW AEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKAR FSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSP VVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFP VGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKS DSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR
    • Amino acids
      1 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD85
    • CD85 antigen-like family member F
    • CD85f
    • ILT-11
    • ILT11
    • Immunoglobulin like transcript 11 protein
    • Immunoglobulin-like transcript 11
    • Leukocyte Ig like receptor 9
    • Leukocyte immunoglobulin like receptor subfamily A (with TM domain) member 5
    • Leukocyte immunoglobulin-like receptor 9
    • Leukocyte immunoglobulin-like receptor subfamily A member 5
    • Leukocyte immunoglobulin-like receptor subfamily B (with TM and ITIM domains) member 7
    • LILRA5
    • LILRB7
    • LIR-9
    • LIR9
    • LIRA5_HUMAN
    see all
  • Function
    May plays a role in triggering innate immune responses. Seems not play a role for any class I MHC antigens recognition.
  • Tissue specificity
    Expressed mostly in tissues of the hematopoitic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells or natural killer (NK) cells (at protein level).
  • Sequence similarities
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Secreted and Membrane. Secreted.
  • Information by UniProt

Images

  • ab166353 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up