Recombinant Human LILRB1 protein (ab151832)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRI PQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYI KPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPH ARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVS KKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQP QAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFY DRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTY QSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPS GGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
    • Molecular weight
      48 kDa including tags
    • Amino acids
      24 to 458
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151832 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • CD85
    • CD85 antigen
    • CD85 antigen like family member J
    • CD85 antigen-like family member J
    • CD85j
    • CD85j antigen
    • Ig like transcript 2
    • ILT 2
    • ILT-2
    • ILT2
    • immunoglobulin like transcript 2
    • Immunoglobulin-like transcript 2
    • leukocyte Ig like receptor 1
    • Leukocyte immunoglobulin like receptor 1
    • leukocyte immunoglobulin like receptor subfamily B member 1
    • Leukocyte immunoglobulin like receptor subfamily B member 1 precursor
    • leukocyte immunoglobulin like receptor subfamily B member 1 soluble isoform
    • leukocyte immunoglobulin like receptor, subfamily B, member 1
    • Leukocyte immunoglobulin-like receptor 1
    • Leukocyte immunoglobulin-like receptor subfamily B member 1
    • leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform
    • leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
    • LILRB1
    • LIR 1
    • LIR-1
    • LIR1
    • LIRB1_HUMAN
    • MIR 7
    • MIR-7
    • MIR7
    • Monocyte/macrophage immunoglobulin like receptor 7
    • Monocyte/macrophage immunoglobulin-like receptor 7
    • PIR B
    • PIRB
    see all
  • Function
    Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. Engagement of LILRB1 present on natural killer cells or T-cells by class I MHC molecules protects the target cells from lysis. Interaction with HLA-B or HLA-E leads to inhibition of the signal triggered by FCER1A and inhibits serotonin release. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.
  • Tissue specificity
    Expressed predominantly on B-cells and monocytes, and at lower levels on dendritic cells. Detected on a low percentage of T-cells and natural killer (NK) cells.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Contains 4 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues. Dephosphorylated by PTPN6.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab151832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up