Recombinant Human LILRB5 protein (ab161226)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQ GPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYY ETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGL LTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYR KNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGY DIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHN LSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI DTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIR SYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQ SGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTSAHFYRPAGAA GPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQ DVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH
    • Amino acids
      1 to 590
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD85 antigen-like family member C
    • CD85c
    • Leukocyte immunoglobulin-like receptor 8
    • Leukocyte immunoglobulin-like receptor subfamily B member 5
    • LILRB5
    • LIR-8
    • LIR8
    • LIRB5_HUMAN
    see all
  • Function
    May act as receptor for class I MHC antigens.
  • Tissue specificity
    Detected in a natural killer (NK) cells.
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161226 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up