Recombinant Human LIMPII protein (ab158058)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIY VKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTLIITN
    • Amino acids
      339 to 437
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 85 kDa lysosomal membrane sialoglycoprotein
    • 85 kDa lysosomal sialoglycoprotein scavenger receptor class B member 2
    • AMRF
    • CD36
    • CD36 antigen
    • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2 (lysosomal integral membrane protein II)
    • CD36 antigen-like 2
    • CD36L2
    • EPM4
    • HLGP85
    • LGP85
    • LIMP 2
    • LIMP II
    • LIMP2
    • LIMPII
    • Lysosomal integral membrane protein II
    • Lysosome membrane protein 2
    • Lysosome membrane protein II
    • OTTHUMP00000160590
    • OTTHUMP00000219176
    • Scarb2
    • Scavenger receptor class B member 2
    • Scavenger receptor class B, member 2
    • SCRB2_HUMAN
    • SR BII
    • SRBII
    see all
  • Function
    Acts as a lysosomal receptor for glucosylceramidase (GBA) targeting.
    (Microbial infection) Acts as a receptor for enterovirus 71.
  • Involvement in disease
    Epilepsy, progressive myoclonic 4, with or without renal failure
    Genetic variants in SCARB2 can act as modifier of the phenotypic expression and severity of Gaucher disease.
  • Sequence similarities
    Belongs to the CD36 family.
  • Cellular localization
    Lysosome membrane.
  • Information by UniProt

Images

  • ab158058 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up