Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP48059
    • SpeciesHuman
    • SequenceMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLF YEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLC QEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFK NDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGD VCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVC KKCYEKFPLELKKRLKKLAETLGRK
    • Molecular weight62 kDa including tags
    • Amino acids1 to 325
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 2310016J22Rik
    • 4921524A02Rik
    • AI507642
    • AU021743
    • AW551584
    • C430041B13Rik
    • LIM and senescent cell antigen like domains 1
    • LIM and senescent cell antigen-like-containing domain protein 1
    • LIM zinc finger domain containing 1
    • LIM-type zinc finger domains 1
    • Lims1
    • LIMS1_HUMAN
    • Lims1l
    • Particularly interesting new Cys His protein
    • Particularly interesting new Cys His protein 1
    • Particularly interesting new Cys-His protein 1
    • PINCH
    • PINCH 1
    • PINCH-1
    • PINCH1
    • Renal carcinoma antigen NY REN 48
    • Renal carcinoma antigen NY-REN-48
    • senescent cell antigen
    • wu:fc32c03
    • zgc:112533
    see all
  • FunctionEffector of integrin and growth factor signaling, coupling surface receptors to downstream signaling molecules involved in the regulation of cell survival, cell proliferation and cell differentiation. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway.
  • Tissue specificityExpressed in most tissues except in the brain.
  • Sequence similaritiesContains 5 LIM zinc-binding domains.
  • Cellular localizationCell junction > focal adhesion. Cell membrane.
  • Information by UniProt

Recombinant Human LIMS1 protein images

  • 12.5% SDS-PAGE showing ab116807 at approximately 61.82kDa.
    Stained with Coomassie Blue.

References for Recombinant Human LIMS1 protein (ab116807)

ab116807 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"