Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9H9Z2
    • SpeciesHuman
    • SequenceGPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVR MGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKS AKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK ECKLPPQPKKCHFCQSISHMVASCPLKAQQGP
    • Molecular weight24 kDa including tags
    • Amino acids3 to 182
    • Additional sequence informationRecombinant fragment including a 13-residue C-terminal TAT peptide.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab107950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityMeasured by its ability to induce fluorescence in Lin28 reporter cells (293 cells transfected with fluorescent protein genes under Lin28 control). Optimum activity was achieved at 20 µg/ml after incubation for 72 hr.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 90 % SDS-PAGE.
    Purity is greater than 90% by SDS-PAGE gel and HPLC analyses.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10mM Sodium citrate, pH 3.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in water to a concentration of 1.0 mg/ml

General Info

  • Alternative names
    • AL024421
    • CSDD1
    • FLJ12457
    • Lin 28
    • Lin 28 homolog
    • Lin 28 homolog (C. elegans)
    • Lin 28 homolog A
    • Lin 28 homolog A (C. elegans)
    • Lin-28A
    • Lin28
    • Lin28, C. elegans, homolog of, A
    • LIN28A
    • LN28A_HUMAN
    • Protein lin-28 homolog A
    • RNA binding protein lin 28
    • Tex17
    • ZCCHC1
    • Zinc finger CCHC domain containing 1
    • Zinc finger CCHC domain containing protein 1
    • Zinc finger CCHC domain-containing protein 1
    see all
  • FunctionActs as a 'translational enhancer', driving specific mRNAs to polysomes and thus increasing the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in stabilizing the mRNAs. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression (By similarity). Acts as a suppressor of microRNA (miRNA) biogenesis by specifically binding the precursor let-7 (pre-let-7), a miRNA precursor. Acts by binding pre-let-7 and recruiting ZCCHC11/TUT4 uridylyltransferase, leading to the terminal uridylation of pre-let-7. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 in embryonic stem (ES) cells contributes to the maintenance of ES cells. In contrast, LIN28A down-regulation in neural stem cells by miR-125, allows the processing of pre-let-7. Specifically recognizes the 5'-GGAG-3' motif in the terminal loop of pre-let-7. Also recognizes and binds non pre-let-7 pre-miRNAs that contain the 5'-GGAG-3' motif in the terminal loop, leading to their terminal uridylation and subsequent degradation.
  • Tissue specificityExpressed in embryonic stem cells (ES cells), placenta and testis.
  • Sequence similaritiesBelongs to the lin-28 family.
    Contains 2 CCHC-type zinc fingers.
    Contains 1 CSD (cold-shock) domain.
  • Developmental stageExpressed in fetal liver. Expression decreases during differentiation of ES cells or upon induction of neuronal differentiation by retinoic acid.
  • DomainThe CSD domain is required for function in muscle differentiation.
  • Cellular localizationCytoplasm. Nucleus > nucleolus. Nucleolar localization observed in 10-15% of the nuclei in differentiated myotubes (By similarity). Shuttles between the cytoplasm and the nucleus. Localizes to cytoplasmic processing bodies and stress granules.
  • Information by UniProt

References for Recombinant human Lin28 protein (ab107950)

ab107950 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"